PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G295100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 158aa    MW: 17268.6 Da    PI: 8.7263
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G295100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_156.75.3e-1885141359
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                         +++r++r+++NRe+A rsR+RK+a++e+Le++v  L  eN +Lkk+ +elk eva+l
  Sevir.4G295100.1.p  85 DDRRTIRMMRNRESALRSRARKRAYVENLEKEVRRLVDENLKLKKQCKELKLEVAAL 141
                         589*************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1483147IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-1684141No hitNo description
PROSITE profilePS5021711.51985141IPR004827Basic-leucine zipper domain
PfamPF001704.3E-1586141IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.19E-1287141No hitNo description
CDDcd147072.08E-1887141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MAANYHHYQM AVAAAAAAWR EPDSPQLSFV SGCSSLFSIS TLQDDDDGAV VIAGHALPST  60
PVSLAGFAGD EVDMEVQQVS GGSGDDRRTI RMMRNRESAL RSRARKRAYV ENLEKEVRRL  120
VDENLKLKKQ CKELKLEVAA LVLPTKSSLR RTSSTQF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0338581e-138BT033858.1 Zea mays full-length cDNA clone ZM_BFc0165B20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966480.11e-113PREDICTED: protein FD-like
SwissprotQ84JK21e-15FD_ARATH; Protein FD
TrEMBLK3XZQ11e-113K3XZQ1_SETIT; Uncharacterized protein
STRINGSi007412m1e-113(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-10bZIP family protein